PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G03250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 199aa    MW: 21525.3 Da    PI: 8.7432
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G03250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.81.6e-10121183163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke e+  +e+ +lk  +
  OPUNC12G03250.1 121 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSTQNESMKKERETVMQEYLSLKETN 183
                      89**********************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-6118186No hitNo description
SMARTSM003381.9E-12121185IPR004827Basic-leucine zipper domain
PfamPF001708.1E-10121184IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.14123186IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.66E-7125181No hitNo description
CDDcd147025.79E-10126176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MSDHSGGEQR QCRRGLAVDV VELGAALALA DMAGVAAAAA AVKPAMQLQP TTTTAAHDED  60
EEMATTRLSL QVGNNVSIIQ SSSCSSSGSS AGRPAPPPPP ATATAPSAYG PKPRHMLTEE  120
EKEAKRLRRV LANRESARQT ILRRQAIRDE LARKVADLST QNESMKKERE TVMQEYLSLK  180
ETNKQLKEQA QHHLSLSLF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankOSU042970.0U04297.1 Oryza sativa Nipponbare bZIP DNA-binding factor (osZIP-2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619098.13e-94PREDICTED: G-box-binding factor 1
TrEMBLA0A0E0MJT91e-143A0A0E0MJT9_ORYPU; Uncharacterized protein
STRINGBGIOSGA037021-PA1e-93(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-15bZIP family protein